> Infused in the bloodstream, scavenger hemoproteins like RcoM-HBD-CCC rapidly bind to carbon monoxide molecules, reducing the time it takes to clear half of the carbon monoxide in the blood to less than a minute, compared to more than hour with pure oxygen therapy and five hours without any treatment.
4 hours ago [-]
lawlessone 3 hours ago [-]
I can see a market in selling this to urban cyclists..
I've seen people doing that get quite a bit of exhaust fumes to the face.
hinkley 2 hours ago [-]
Breath control is an underrated skill.
jfarlow 7 hours ago [-]
Here's the full sequence of the protein, found in the supplement [1]
Thanks for that sequence, I can really picture it now
dekhn 3 hours ago [-]
You can search for it here:
https://alphafold.ebi.ac.uk/search/sequence/KSSEPASVSAAERRAE...
and in principle get the AlphaFold predicted structure (I couldn't find an experimentally determined one). However, like nearly all EBI resources, the web server timed out before I could get a link to the prediction.
immibis 2 hours ago [-]
Isn't it strange to see protein codes spreading the same way magnet links or AACS encryption keys might.
"Methylene Blue as an Antidote to CO Poisoning", Matilda Moldenhauer Brooks
skadamou 4 hours ago [-]
This paper is interesting but I want to point out there is a difference between a research paper showing that something is hypothetically feasible and something that is actually useful clinically.
Clinically, methylene blue is used to treat a different condition, methemeglobinemia and is not used to treat carbon monoxide poisoning which relies on hyperbaric oxygen therapy.
kazinator 1 hours ago [-]
The researcher used non-human animals; it worked on them.
The hypothetical part was only that it might also work on humans.
In any case, it seems the result was good enough as a clinical trial from the point of view of veterinary medicine, in regard to those specific types of animals.
searine 7 hours ago [-]
This research was funded by multiple NIH grants, a Department of Defense grant, and the Martin Family Foundation.
5 hours ago [-]
dtgriscom 8 hours ago [-]
How is this administered? Seems like a crucial detail to omit.
elric 7 hours ago [-]
> This has the potential to become a rapid, intravenous antidote for carbon monoxide
So intravenously, presumably.
DonHopkins 8 hours ago [-]
You can spread it on bread, melt it over pancakes, rub it all over corn on the cob, put it in baked potatoes, etc, promise!
sandworm101 3 hours ago [-]
CO poisioning is one of those strange cases treatable using scuba diving. Recompression therapy, which can be theoretically aped under water, can be like magic. In some cases the patient just wakes up like nothing is wrong. No drugs. No invasive treatment. Get deep enough and hemoglobin isnt totally necessary for getting O2 where it needs to be.
It looks like he found a note in his room and see some strange thing in the window, and someone somehow says it's CO but it may be that the OP has unrelated hallucinations. Is this a symptom of CO poisoning? I think you only get sleepy, faint and die.
maxbond 8 hours ago [-]
Chronic exposure can lead to memory loss, yes. You're describing the symptoms of acute exposure.
hinkley 8 hours ago [-]
CO exposure is accumulative. If you’re around an intense source of it you’re toast. But with a small point source or decent ventilation it kills you slower.
And your body produces new blood cells every day, so minor sources like wood smoke or burning a candle don’t dose you enough to be a problem, unless perhaps your day job is as an athlete.
hinkley 5 hours ago [-]
Also looks like the half-life of CO in the blood is around five hours.
DonHopkins 10 hours ago [-]
>New Protein Therapy Shows Promise as Antidote for Carbon Monoxide Poisoning
So Shatner was right all along: not only is Promise Margarine good for lowering your cholesterol level, but it can also treat carbon monoxide poisoning! And it tastes like butter, promise.
I don't see a relation of any kind and I hate commercials maybe more than anybody else, but it's always a good time for a funny one with Shatner :)
DonHopkins 8 hours ago [-]
Sheez, I can't believe I have to explain that Shatner shows Promise as antidote for high cholesterol too.
selimthegrim 5 hours ago [-]
He just played New Orleans. Somebody should’ve been throwing tubs of Promise margarine at the stage.
10 hours ago [-]
heyoleftycunts 5 hours ago [-]
[flagged]
narrator 10 hours ago [-]
[flagged]
skadamou 6 hours ago [-]
Methylene blue is actually used to treat acquired cases of a similar condition called methemeglobinemia which is when the iron in heme is oxide from Fe2+ to Fe3+ [1]. This is different from carbon monoxide poisoning which is caused by carbon monoxide binding more tightly to hemoglobin than oxygen preventing oxygen from effectively getting into your blood.
Ahh I bet that is where the confusion is. I am a physician and I have used methylene blue in severe shock and methemoglobinemia but I was a bit worried the parent comment believed it’s a valid CO treatment.
kazinator 5 hours ago [-]
Initially suspecting that since CO poisoning and methemeglobinemia are not the same, methylene blue might not work in CO cases, I did about three seconds of web searching and found a 1933 paper about an experiment (on animals) showing methylene blue to be effective in CO poisoning.
Herodotus38 7 hours ago [-]
Hello, I would be interested if you could give evidence that methylene blue "works great" for carbon monoxide poisoning in humans.
IANAMD I made a quick search and the evidence of methylene blue as a carbon monoxide antidote looks controversial.
IIUC part of the effect is oxidizing/reducing the iron atom in the hemoglobin, and that changes how strong is the bound with the O2, CO, NO. But my chemistry is not enough to give a good guess of the results.
God forbid we have alternatives that work in minutes
lagniappe 7 hours ago [-]
Given that MB is commonly supported by those with right leaning politics, if the above is true, it won't be reported on for risk of appearing to support the "wrong" party.
darth_avocado 7 hours ago [-]
Why would a treatment be not made available if it’s effective? What’s the conspiracy in letting people suffer and die?
immibis 2 hours ago [-]
Well, money would be the most obvious one, but the parent comment is talking about the anti-science regime currently in power in the USA. I can't remember which, but I thought I read they banned some effective treatments because RFK Jr (famous conspiracy theorist now in charge of the country's health) didn't believe in them. They shut down research into mRNA medicines. at least, because they think it's population control to keep you docile, or something like that. There was also a mass shooting at a CDC office on similar grounds.
jayd16 7 hours ago [-]
It's been around for a century but it's a political conspiracy to keep it unknown??
Traubenfuchs 7 hours ago [-]
[flagged]
jrajav 7 hours ago [-]
"hey, speeding down the highway 35mph over the limit could kill you, especially if you are fat and old. you SHOULD drive under the speed limit, but you don't have to."
No, the point is that it could kill other people. Speed all you want when you're on your own private roads.
Laws are generally meant to ensure public safety and the ability for us to live and cooperate together with mutual trust. They usually do end up restricting your personal freedoms to that end. Deal with it.
I've seen people doing that get quite a bit of exhaust fumes to the face.
KSSEPASVSAAERRAETEQHKLEQENPGIVWLDQHGRVTAENDVALQILGPAGEQSLGVAQDSLEGIDVVQLHPEKSRDKLRFLLQSKDVGGSPVKSPPPVAMMINIPDRILMIKVSSMIAAGGASGTSMIFYDVTDLTTEPSGLPAGGSAPSHHHHHH
It is a protein encoding the PxRcoM-1 heme binding domain with C94S mutation and a C-terminal 6xHis tag (RcoM-HBD-C94S)
[1] https://www.pnas.org/doi/10.1073/pnas.2501389122#supplementa...
1933 paper:
https://journals.physiology.org/doi/abs/10.1152/ajplegacy.19...
"Methylene Blue as an Antidote to CO Poisoning", Matilda Moldenhauer Brooks
Clinically, methylene blue is used to treat a different condition, methemeglobinemia and is not used to treat carbon monoxide poisoning which relies on hyperbaric oxygen therapy.
The hypothetical part was only that it might also work on humans.
In any case, it seems the result was good enough as a clinical trial from the point of view of veterinary medicine, in regard to those specific types of animals.
So intravenously, presumably.
https://www.ncbi.nlm.nih.gov/books/NBK470531/
- [MA] Post-it notes left in apartment [0]
- and the update from OP a while later [1]
[0]: https://www.reddit.com/r/legaladvice/comments/34l7vo/ma_post...
[1]: https://www.reddit.com/r/AskReddit/comments/49zfvb/what_is_t...
And your body produces new blood cells every day, so minor sources like wood smoke or burning a candle don’t dose you enough to be a problem, unless perhaps your day job is as an athlete.
So Shatner was right all along: not only is Promise Margarine good for lowering your cholesterol level, but it can also treat carbon monoxide poisoning! And it tastes like butter, promise.
https://www.youtube.com/watch?v=n3wf717fKFE
[1] https://www.uptodate.com/contents/methemoglobinemia?search=m...
It is not the standard of care in any guidelines I can find from any country. There is a paper from 2018 out of china showing some benefit in a rat model: https://onlinelibrary.wiley.com/doi/10.1111/bcpt.12940
IIUC part of the effect is oxidizing/reducing the iron atom in the hemoglobin, and that changes how strong is the bound with the O2, CO, NO. But my chemistry is not enough to give a good guess of the results.
https://www.reddit.com/r/medlabprofessionals/comments/16lep3...
https://www.youtube.com/watch?v=9GYtgFdXCGE
No, the point is that it could kill other people. Speed all you want when you're on your own private roads.
Laws are generally meant to ensure public safety and the ability for us to live and cooperate together with mutual trust. They usually do end up restricting your personal freedoms to that end. Deal with it.